Categories
- PROTAC Linker
- Protein Control Ligand
- Pathway Inhibitors
- Function Modulators
- Activators
- G Protein-Coupled Receptor Ligands
- Nuclear Receptor Ligands
- GDNF Receptors
- TNF Receptors
- Transcription Factors
- Chemokines
- Cytokine Receptors
- Biomarkers and Buffer Solutions
- Molecular Probes
- Stem Cell Research
- Alzheimer's Disease
- Apoptosis
- Cancer Research
- Epigenetics
- Metabolites
- PET/SPECT Imaging Precursors
- Customized Screening Library
- Ultra Pure Pharmacological Standard
- Tissue Microarray (TMA)
- Proteins and Antibodies
- Primary Cells
- ELISA KIT
- Natural Products
- Lab Equipments
- Humanized Mice for PDX Platform
- Rare Chemicals
- Custom Synthesis
- Antibacterial
- Antifungal
- Antioxidant
- Antiviral
- Molecular Glues
- SARS-CoV
Quantity Discount Table - Order More To Get More Price Discount
| Quantity | mg | Unit Price ($/mg or $/Unit) | Final Price |
|---|---|---|---|
| 1 | 5 | $127.50 | Total: $637.50 |
| 1 | 10 | $108.00 | Total: $1,080.00 |
| 1 | 25 | $91.50 | Total: $2,287.50 |
| 1 | 50 | $78.00 | Total: $3,900.00 |
| 1 | 100 | $67.50 | Total: $6,750.00 |
Overview
Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells
Chemical Properties
| Molecular Weight | 4.4 kDa |
| Stock Solution Guide | 5 mM in 100 uL of sterilized water |
| Purity | Greater than 95% |
| Amino Acid Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Shipping Condition | Cold pack |
Storage and Handling
4C for up to 3 months without losing activity (do not freeze)
Customers who bought this product also bought:
-
$35.00
-
$36.50
-
$39.00
