No products
View larger KET4003
Alternative Name: MIP-3 alpha
500 Items
| Molecular Weight | 8025.5 Da |
| Storage Condition | Lyophilized powder; Store at -20C |
| Solubility | Freely soluble in water |
| Purity | Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR |
| Amino Acid Sequence | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
| Shipping Condition | Room temperature |
C-C motif chemokine 20 (CCL20) or liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP-3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. CCL20 is a ligand for the G protein coupled receptor CCR6.