Quantity | = | Concentration | x | Volume | x | Molecular Weight |
---|---|---|---|---|---|---|
= | x | x |
1) Click the Molarity Calculation Cart® button.
2) Specify the Concentration and Volume of your desired Molarity.
3) Click Calculate.
4) Your desired Quantity will be calculated and will be put under Quantity: (only for mg)
5) Click Add to Cart and then Proceed to checkout to complete the order. You will receive the quantity as you ordered as solvent-free form.
Alert: If you want to make a solution with a solvent (such DMSO), please add instructions in the notes section (such as 10 nM/1 mL in DMSO) and we will pack and deliver the product as a solution (such as 10 nM solution in 1 mL DMSO). If the product cannot be dissolved in DMSO or you would like to specify your own preferred solvent, please add detailed instructions in the notes section. All solutions must be shipped with an ice bag, costing an additional fee of $20 for S&H.
KET4004
Alternative Name: SDF-1 alpha
Warning: Last items in stock!
Availability date:
Molecular Weight | 7959.4 Da |
Storage Condition | Lyophilized powder; Store at -20C |
Solubility | Freely soluble in water |
Purity | Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR |
Amino Acid Sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Shipping Condition | Room temperature |
C-X-C motif chemokine 12 is small cytokine belonging to the chemokine family that is also known as SDF-1 (stromal cell-derived factor-1). CXCL12 is a ligand for the G protein coupled receptor CXCR4