No products
View larger | Molecular Weight | 8352.8 Da |
| Storage Condition | Lyophilized powder; Store at -20C |
| Solubility | Freely soluble in water |
| Purity | Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR |
| Amino Acid Sequence | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
| Shipping Condition | Room temperature |
C-X-C motif chemokine 5 (CXCL5) or epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a protein that in humans is encoded by the CXCL5 gene. The protein is a small cytokine belonging to the CXC chemokine family. CXCL5 is a ligand for the G protein coupled receptor CXCR2, and is expressed in monocytes, platelets, endothelial cells and mast cells