No products
View larger KET4006
Alternative Name: Lymphotactin
1000 Items
| Molecular Weight | 10269.7 Da |
| Storage Condition | Lyophilized powder; Store at -20C |
| Solubility | Freely soluble in water |
| Purity | Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR |
| Amino Acid Sequence | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Shipping Condition | Room temperature |
C motif chemokine 1 (XCL1) is a small cytokine belonging to the XC chemokine family that is also known as lymphotactin. It is found in high levels in spleen, thymus, intestine and peripheral blood leukocytes, and at lower levels in lung, prostate gland and ovary. XCL1 is a ligand for the G protein coupled receptor XCR1 with an EC50 ~ 50 nM