No products
View larger AOB13064
Natural Killer (NK) Cell Activating Peptide
986 Items
| Quantity | mg | Unit Price ($/mg or $/Unit) | Final Price |
|---|---|---|---|
| 1 | 5 | $127.50 | Total: $637.50 |
| 1 | 10 | $108.00 | Total: $1,080.00 |
| 1 | 25 | $91.50 | Total: $2,287.50 |
| 1 | 50 | $78.00 | Total: $3,900.00 |
| 1 | 100 | $67.50 | Total: $6,750.00 |
| Molecular Weight | 4.4 kDa |
| Storage Condition | 4C for up to 3 months without losing activity (do not freeze) |
| Stock Solution Guide | 5 mM in 100 uL of sterilized water |
| Purity | Greater than 95% |
| Amino Acid Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Shipping Condition | Cold pack |
Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells