Cart 0 Product Products (empty)
No products
Free shipping! Shipping
$0.00 Total
Product successfully added to your shopping cart
Quantity
Unit
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) Free shipping!
Total (tax excl.)
Proteins and Antibodies
- Protein Control Ligand
- Pathway Inhibitors
- Enzyme Inhibitors
- Kinase Inhibitors
- Protease
- Synthase
- p18
- p38
- p53
- p70
- p90
- Peptidase
- Carboxyl and Decarboxylases
- Ceramide Turnover Enzymes
- Chromatin Modifying Enzymes
- Cyclic Nucleotide Turnover Enzymes
- Glycerophospholipid Turnover Enzymes
- Hydroxylases
- Ubiquitin-Activating Enzyme
- Adenosine Deaminase
- Clathrin
- Nuclease
- p68
- Protein Inhibitors
- Transporter Inhibitors
- Cell Inhibition
- Synthase
- Receptor Tyrosine Phosphatases (RTP)
- Enzyme Inhibitors
- Function Modulators
- Activators
- G Protein-Coupled Receptor Ligands
- 5HT Receptors
- Adrenoceptor
- Angiotensin Receptor
- Cannabinoid Receptors
- CCK Receptors
- DA Receptors
- EAA Receptors
- Ghrelin Receptors
- GABA Receptors
- Histamine Receptors
- Leukotriene Receptors
- Metabotropic Glutamate Receptors
- Motilin Receptors
- Muscarinic Receptor
- Neuropeptide Receptors
- Opioid Receptors
- Orexin Receptors
- Orphan Receptors
- Prostanoid Receptors
- Proteinase-Activated Receptors
- Purinergic Receptors
- Ryanodine receptor
- Sigma Receptors
- Thrombin Receptor
- Vaniloid Receptor
- VIP and PACAP Receptors
- Neurotensin Receptors
- Urotensin Receptor
- Imidazoline receptor
- SMO Receptors
- Apelin Receptor
- β-arrestin/β2-adaptin
- KDM4
- Glucocorticoid Receptor
- Laminin Receptor
- Nuclear Receptor Ligands
- GDNF Receptors
- TNF Receptors
- Transcription Factors
- Chemokines
- Cytokine Receptors
- Biomarkers and Buffer Solutions
- Molecular Probes
- Stem Cell Research
- Alzheimer's Disease
- Apoptosis
- Cancer Research
- Epigenetics
- Metabolites
- PET/SPECT Imaging Precursors
- Customized Screening Library
- Ultra Pure Pharmacological Standard
- Tissue Microarray (TMA)
- Proteins and Antibodies
- Primary Cells
- ELISA KIT
- Natural Products
- Lab Equipments
- Humanized Mice for PDX Platform
- Rare Chemicals
- Custom Synthesis
View larger 
Lunasin
AOB13064
Natural Killer (NK) Cell Activating Peptide
Molarity Calculation Cart®
HOW TO ORDER
Quantity Discount Table - Order More To Get More Price Discount
| Quantity | mg | Unit Price ($/mg or $/Unit) | Final Price |
|---|---|---|---|
| 1 | 100 | $67.50 | Total: $6,750.00 |
| 1 | 50 | $78.00 | Total: $3,900.00 |
| 1 | 25 | $91.50 | Total: $2,287.50 |
| 1 | 10 | $108.00 | Total: $1,080.00 |
| 1 | 5 | $127.50 | Total: $637.50 |
Data sheet
| Molecular Weight | 4.4 kDa |
| Storage Condition | 4C for up to 3 months without losing activity (do not freeze) |
| Stock Solution Guide | 5 mM in 100 uL of sterilized water |
| Purity | Greater than 95% |
| Amino Acid Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Shipping Condition | Cold pack |
More info
Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells
Customers who bought this product also bought:
-
$31.00
-
$36.50
-
$39.00
-
$35.00