Quantity | = | Concentration | x | Volume | x | Molecular Weight |
---|---|---|---|---|---|---|
= | x | x |
1) Click the Molarity Calculation Cart® button.
2) Specify the Concentration and Volume of your desired Molarity.
3) Click Calculate.
4) Your desired Quantity will be calculated and will be put under Quantity: (only for mg)
5) Click Add to Cart and then Proceed to checkout to complete the order. You will receive the quantity as you ordered as solvent-free form.
Alert: If you want to make a solution with a solvent (such DMSO), please add instructions in the notes section (such as 10 nM/1 mL in DMSO) and we will pack and deliver the product as a solution (such as 10 nM solution in 1 mL DMSO). If the product cannot be dissolved in DMSO or you would like to specify your own preferred solvent, please add detailed instructions in the notes section. All solutions must be shipped with an ice bag, costing an additional fee of $20 for S&H.
AOB13064
Natural Killer (NK) Cell Activating Peptide
Warning: Last items in stock!
Availability date:
Quantity (mg or Unit) | Unit Price ($/mg or $/Unit) | Final Price |
---|---|---|
100 | $67.50 | Total: $6,750.00 |
50 | $78.00 | Total: $3,900.00 |
25 | $91.50 | Total: $2,287.50 |
10 | $108.00 | Total: $1,080.00 |
5 | $127.50 | Total: $637.50 |
Molecular Weight | 4.4 kDa |
Storage Condition | 4C for up to 3 months without losing activity (do not freeze) |
Stock Solution Guide | 5 mM in 100 uL of sterilized water |
Purity | Greater than 95% |
Amino Acid Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
Shipping Condition | Cold pack |
Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells